Query Sequence
>AZOBR_RS15680
IRAFSYNEFLFLLSAVQWTLALSAIAFIGGATVGLVIALARTSDIKAVRLAATGYIQLFQGTPLLMQLFLVFFGATVMGLDLNPWAAAALGLTLNASAFLGEIWRGCIQAVPRGQWEAASALGLRYPGLMRYVILPQAVKVAVPPTVGFLVQLIKSTSLAAIIGFTELTRAGQIVNNATFQPFLVFGIVAVLYFLMCWPLSLLSARLERRYALATR
Hit FamilyFIG01121964
Hit Family Functionpolar amino acid ABC transporter, inner membrane subunit


back to search