Query Sequence
>AZOBR_RS13230
MAKTMKAAVVRQFKMPLSIEEVPVPEVGPGQILVKIEASGVCHTDLHAADGDWPVKPNPPFIPGHEGVGTVAAVGTGVTAVKEGDRVGVPWLHTACGHCRQCLAGWETLCDLQQNTGYSVNGGFAEYTLADPNYVGHLPDRLDWEMAAPILCAGVTVYKGLKETDTKPGDTVVISGIGGLGHIAVQYAKAMGLDVIAVDISDEKLALARAMGADAAINAKTTDPVAEVKALCGGAQGVLVTAVSRHAFNQALGMLAKRGTMALVGLPPGSFELDIFSTVLMRKTIRGSIVGTRLDLAECLQFAGDGKVKVHYSVEHLDNINNVFSRMRNNEIDGRVVMRM
Hit FamilyFIG01007502
Hit Family FunctionAlcohol dehydrogenase (EC 1.1.1.1)


back to search