Query Sequence
>AZOBR_RS07390
MSQFRLLHTMLRVYDLEKSLDFYTRLLGMKLLRRNDYEGGRFTLAFVGYGDEKDTAVLELTHNWDQAEPYAIGTAYGHIALGVPDIYATCEQLAKEGVKIPRPPGPMKHGTTVIAFIEDPDGYKVELIETK
Hit FamilyFIG00004743
Hit Family FunctionLactoylglutathione lyase (EC 4.4.1.5)


back to search