Query Sequence
>AZOBR_RS05730
MTVTTVKPDSAAQAADAVRWALSEGTPLDVAGSGSKRGLGRPIQTAYTLDLSGLSGVVAYEAEELVLTARAGTPMAEILPMLAERRQQFAFEPQDLGPLFGRPEGQGTLGGVISCGLAGPRRISAGSARDHTLGIEGVNGRGDLYKGGGKVVKNVTGYDVPKLMAGSFGTLTVLTELTVKVLPASEDVRTLLLAGREDAGAVAALTAALQSPYDVSGAAHLPAAVAARSHVRAVAAVGGAVTLVRVEGFGPSVIARVAALKEELGADAVLDRDESLAVWKEVRDVAYFGPTPSPASAGEGWGGGEDSRHIWKISVQPSEGPRVAESIRWALDAELYFDWGGGLIWAAVAPTPDAASAIRGALGTAGHATLVRAPEDVRTTTEVFHPLPDPVKALSRRVKESFDPCGILNPGRMYAGV
Hit FamilyFIG00027246
Hit Family FunctionGlycolate dehydrogenase (EC 1.1.99.14), FAD-binding subunit GlcE


back to search