Query Sequence
>AZOBR_RS05480
MHIVVCIKQVPDSAQIRIHPVTNTIMRQGVPAIINPFDLFSLEEALRIKDKVGARVTVLTMGPPMAETSLRKALSLGADDAVLLTDRKFAGSDTLATSYALTSAIKKLSEEEQVDLVFCGKQTVDGDTAQVGPGIATRLGFQQLTYITKIESIDQGAREIVVHRRSEGGVQVLKTALPCMITMLEGTNTIRFGKMDDMFRAARYGLKTWNKDTTGAEETKVGLKGSPTVVSKVFVPKPRAQKATMVEAETPTAEAQAAAAVDAIFGAQPKLADELLARAAAGL
Hit FamilyFIG01304886
Hit Family FunctionElectron transfer flavoprotein, beta subunit


back to search