Query Sequence
>AZOBR_RS01765
MTISGKATLAGVMGWPIGHSRSPRLHGYWLEQYGIDGAYVPLAVPPDRIEQAIRALPALGFRGCNVTVPHKEAACRTVDRLDATAKRMGAVNTIVVGENGSLEGRNTDGFGFIENLRSGAPGWKAADGPALVIGAGGAARAVVASLLDEGAPRVWLVNRTRARADELAADIGGAIETADWVSRETLLEGAALVVNTTTQGMAGQPPLELNLRALPGSAVVTDIVYTPLMTPLLTAAQARGNRVVDGVGMLLHQARPGFAAWFGREPEVTEGLKAAVLQG
Hit FamilyFIG01961768
Hit Family FunctionShikimate 5-dehydrogenase I alpha (EC 1.1.1.25)


back to search