Query Sequence
>AZOBR_RS00690
MHRHPPTNPNAPEAVLVENVHKRFGPLEVLKGVSLTAREGDVITLIGSSGSGKSTLLRCINMLEVPDEGRIVIGGEAIGLKKARGGQTVPADSRQVDRIRTRLGMVFQSFNLWTHMTILENVIEAPVHVLGVPKAEAVDRARKLLDKVGILAKAESYPVQLSGGQQQRAAIARALAMQPKVMLFDEPTSALDPELVGEVLLVIRQLAEEGNTMILVTHEMGFAREVASEVVFLHQGRIEERGPPDRVLVNPESDRVRQFLSRHLSGGG
Hit FamilyFIG01304156
Hit Family FunctionArginine/ornithine ABC transporter, ATP-binding protein AotP


back to search