Query Sequence
>AZOBR_RS00680
MFELLSFGPNGWGGQLLGGAAMTVAVSVSAFVLGLVFGSLGASAKLSRNLALTGVAEVYTTVVRGVPELLVIYLLFFGGSGAVMAVGRVFGYEGYIELNAFSIGVLAVGLISGAYSTEVIRGAVQAVPHGQIEAARACGMSRWLILRRILVPQTLRYALPGLGNVWQLTLKDTALISVTALAEIMRVSHVAAGSTRQPFLFYTTAAVLYLLLTTVSTVAFERAERYANRGVRRA
Hit FamilyNo hits found for this sequence


back to search