Query Sequence
>AZOBR_RS00675
MNWDLMWDSVPTLLRGVPVTLQLVGLALLFGAGVAFAVALLRLYGNRVTERLMAAYVFVFRGTPLLVQIFLIYYGMGQFELVRSSFLWVYLREPFWCAILALTLNTGAYTSEILRGAILSVPQGQIEAARACGMSRTLLFRRIMMPVAIRQMLPAYGNEVILMVKASSLASTITLLEITGIARKIIAQSFAVFEVFIVAGSIYLLLNFIASRLIRYAEWRMTPYLRARG
Hit FamilyFIG00012250
Hit Family FunctionHistidine ABC transporter, permease protein HisM (TC 3.A.1.3.1)


back to search