Query Sequence
>AZOBR_RS00495
MTASLLQDAVLVTGAGRRVGLHLAERMMALGHPVIAHYRTPTDGVERLRAAGAVCLQGDLADPDGGPRLAEAVRAVAGSLRAVIHNASAFEVTAPDTADALRQLDVFHAVHVRAPFALNRELAPLLDACSARRADIVHITDIYADNPNPAFDAYCASKAGLQNLALSFAKRLAPKVKVNVVQPGPILFKEWHGPEARARVLSETLLGEEGGVEAIGMAVEAILRNHYQTGAVVAVDGGRRLA
Hit FamilyFIG00138402
Hit Family FunctionFolM Alternative dihydrofolate reductase 1


back to search