Query Sequence
>AO356_29555
MNAPIVSFNHVGKSFDVDGFELEAIREFNLDIAEGEFVAIVGSSGCGKSTLLRLLVGLDTQFSGEIRVDGQTVSGIGGERGIVFQEHRLFPWLTVAENIGLGLVNEPIGQAERNRRISDFIELVGLSDFTRAYPHQLSGGMAQRVAIARGLVASPRILLLDEPFGALDALTRQQMQDELLAIRDRAKITTVLVTHDVEEAIFLADRVVVMEPRPGRIKQVVDVALPHPRQRSSFEFHQLREELLHELTSDDHYQPPVREQIRDLPLAFIAC
Hit FamilyFIG00061912
Hit Family FunctionAlkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB


back to search