Query Sequence
>AO356_29235
MKPGAYENGLEQSKANYLPLTPLGFLDRAALVHPDRVAVVHGDLRRTWRQTRERCYRLASALSNEGMGAGDTVSILSPNTPAMLEAHFGVPLCGAVLNTVNYRLDAEGVAFILRHGECKLLLVDREFAALAVAALERLEHPPVVIDINDHLAPLGSSIGDVDYETFIGRGSPDFQGVWPSDEWQPIALNYTSGTTGDPKGVVASHRGTYLMSMLQMTNWPLSRAPRYLWTLPMFHANGWCFTWAITAAAGTHVCLRKVSAEAVFDAIDTQGVDHFCAAPIVMAMIANSADRPPLETPVRVLTAGSPPPATVLDAVVSLGFDVDHVYGITEVSGTPISCVWQDGWNALAQSDQGALRVRQGARAAGFEGLMVADADTLQPVPKDGHTTGELLLKGNTVMMGYLKNENATRKAFEGGWFHTGDVAVVHPNGYIQITDRCKDVIISGGENISSVEIEEAIHCHPAVLHAAVVAQPDDIWGEVPCAFIELKGGAERPTEADMIAFCQARLARFKCPRRVIFMELPKTATGKIQKFLLREQAGSRDAIVRLASSG
Hit FamilyFIG01337818
Hit Family Function3-methylmercaptopropionyl-CoA ligase (DmdB)


back to search