Query Sequence
>AO356_28890
MQRIPCVLMRGGTSKGPVFLAWDLPVAIAERDELLLNLMGSGHELEIDGIGGGSPQTSKVAIVSPSLHPDADVDYLFVQVMVSQRRVDTAPNCGNMLCAVGPFAIEQGLVKPSGDLTRVRIRNLNTGTFVNAEVQTPQGKVSYEGDTAIDGVPGTAAPVQLTFLDAAGSKTGKLFPTGQLLDLIDGILVTCIDMAMPMMIVEASQLGKRGDESPAELDADKAFLQRLESLRLKAGLAMGLGDVSDKVIPKPVLVSPAKCGGTIQVRYFMPHNCHRALAITGSIGLATACVTEGSVVAQLLGNVSEPRLQQVRIEHPSGGIDVVLSYTGEKGETIRASVVRTARRLFSGYVYATASQRLAG
Hit FamilyFIG00958978
Hit Family FunctionFIG00958979: hypothetical protein


back to search