Query Sequence
>AO356_28440
MQPIRLGLVGYGKIAQDQHVPAILANPAFQLVAVATQGQPCAGVENFRSLGELLENGPHVDAIAFCTPPQGRFALVQQALAAGKHVLVEKPPCATLGEAMALVEQVREQGVSGLFAWHSRYAPGIAAARDWLASRTLHSVQIDWKEDVRKWHPGQAWIWQPGGLGVFDPGINALSIATHLLALPLFVEAAELRVPDNCQSPIAASIKMADARHLDIRAEFDFDHGHDELWSIEIRCAEGVLRLDNGGALLSIDGVRQAVSEEGEYAAVYRHFQQLINDKASDMDLQPLRLVADSFFVGSRTAVEPFYD
Hit FamilyFIG00731707
Hit Family FunctionUncharacterized oxidoreductase ydgJ (EC 1.-.-.-)


back to search