Query Sequence
>AO356_27965
MSAPKSHLLSQVIESECVFNGDWVPASGPLQSIIEPATGERLMRCAMADSADIAKASRDAALAQPAWAALGPRQRAAIFRKAADVAEQSFDELALYVARETGAALFKGQHEMREAIVLLHQAAGLLSQAHGVVLPSEAGRLSYARRQPHGVVGVISPFNFPLVLSMRSVAPALAAGNAVVLKPDPQTPVSGGFLIARLFEVAGLPKGLLQVLPGAADAGEALCRDPNVRMIAFTGSTGAGRKVAEVAGRNLKKVALELGGKNPLIILEDADLDLAARNAAWGAWLHQGQICMATGLILAHESIAAELTRKLVEKAQAMTLGNAAREEAAMGPLINQRQLQRVHDIVSDTVLAGARLEAGGDHDRLFYQATVLSGVKPGMRAFDEEVFGPVATVVSFATDDEAIELANRTEYGLAAAIISPSVGRAMAIGERLQCGMLHINDQTVADECVNPFGGRGASGNGGSVGGPADWDEYTQWQWVTVKDTAPIYPF
Hit FamilyFIG00004809
Hit Family FunctionPutative benzaldehyde dehydrogenase oxidoreductase protein (EC 1.2.1.28)


back to search