Query Sequence
>AO356_26080
MSAPSDHAASCTLSFDALVSLLEKIFLRHGTSTEVARCLAENCAGAERDGAHSHGVFRLPGYVSTLNSGWVNGKAVPVVEDVASGFVAVDAGNGFAQPALAAARPLLVEKARSAGIAVLAIRNSHHFAALWPDVEPFAYEGLVALSVVNSMTCVVPHGADRPLFGTNPIAFAAPRADGEPIVFDLATSAIAHGDVQIAARKGELLPPGMGVDSLGQPTRDPKAILEGGALLPFGGHKGSALSMMVELLAAALTGGNFSFEFDWSNHPGAKTPWTGQLLIVIDPSKTAGQDFAERSRELVRQMHGVGLRRLPGDRRHRERSKANEQGISLDEQTLAQLRELAGI
Hit FamilyFIG00070480
Hit Family FunctionDelta 1-piperideine-2-carboxylate reductase (EC 1.5.1.21) / Delta 1-pyrroline-2-carboxylate reductase (EC 1.5.1.1)


back to search