Query Sequence
>AO356_21850
MRTLVIAEHSAGQLTAGTWSAVTAAMALGTETDLLVMGGTAASAVAQQAALTQGLARVLLAQGAMFENALAENVQPLVTSLVAEGYTHVVADASSMGRNVLPRIAASLDVGMLSDVTQIVSTDTFQRPIYAGNAIATVQSLDPIKLLTVRASAFAQALSHEHRCEVVVVEGGQSASNVRFVSEQLTASERPDLSSARVVVSGGRGMQGKEHFALIERVADKLGGAVGASRAAVDSGFAPNDLQVGQTGKIVAPELYIAAGISGAIQHLAGMSGSKVIVAINQDAEAPIAQVADYMWVADLFEALPALEKAL
Hit FamilyFIG00136866
Hit Family FunctionElectron transfer flavoprotein, alpha subunit


back to search