Query Sequence
>AO356_21790
MSVMQTPEGRIDIRQLSIVLGEGAQAFEAVQGLDCQIEAGQFVCVLGPSGCGKSTLLGALAGHLQPRSGSLNVDGLNVSGPSPQRGMVFQQHTLFPWRSVRDNVAFGLKMRGLGKAERHRAADEILALVGLEGFAGHWPDQLSGGMQQRVEIARVLVNRPRLLLMDEPFGALDALTRLNMQELLLDIWTRIRTTVVFVTHDIDEALFLADRLLVMSPRPGRIIEDLRLDFPRPRTTELVTRPEFSRLKRHCLDLLRHEDGRQLPRLNPLGLPPETSLPRFAL
Hit FamilyFIG00017942
Hit Family FunctionVarious polyols ABC transporter, ATP-binding component


back to search