Query Sequence
>AO356_21785
VSPLSKRWLLRAASLLLCLLFWQLAATGHWNLGLVTFANVPTPLAVIQAALGLGESGNLGRHLGSSLGRVFAGYGAALLIGVALGLAIGRSKWAEDLLLPPLEVLRPIPAVAWIPLAILMFPSSELSMVFITFTGALFPILLNTVHGVEGVDRRLIASAKSLGAGRGAILLEVILPGAAPSIITGLAIGMGTSWFCLVTAEMIAGQYGIGYYTWASYTVQNYADIVVGMLLIGVLGMGSSLLIKRLGGLFTPWHRPRGKA
Hit FamilyFIG00138354
Hit Family FunctionAlkanesulfonates transport system permease protein


back to search