Query Sequence
>AO356_19720
MKVLKGQDILALGFMTFALFVGAGNIIFPPIVGLQSGPHVWMAALGFLITAVGLPVITVVALAKVGGAMDALSSPIGKVAGGLLAAVCYLAVGPLFATPRTATVSFEVGLAPLTGESPLALFLYSAAYFLLVFFISLYPGRLLDTVGRFLAPLKIIALAVLGIAAFALPAGDIGVATPEYVAAPFSQGFINGYLTMDTLGALVFGIVIVNAIRSRGVESPALITRYAIIAGLIAGVGLALVYVSLFRLGSGSHEVAMGATNGAAVLHAYVQHTFGSLGSGFLAVLISLACLVTAVGLTCACAEYFSRVLPLSYKTLVVILAAFSLLVSNLGLTKLIAFSIPVLTAIYPPCIALVALSFCKDFWHEQGRIVGPVMLVSFLFGLIDALKGAGLADWMPTQLAHLPLSEQGLAWLVPSVMTLVVAVVCDRLLGKRSEALA
Hit FamilyFIG00905542
Hit Family FunctionBranched-chain amino acid transport system carrier protein


back to search