Query Sequence
>AO356_18725
MSVEQAAVQRADFDQVMVPNYAPAAFIPVRGAGSRVWDQSGRELIDFAGGIAVNVLGHAHPALVGALTEQANKLWHVSNVFTNEPALRLAHKLVNATFAERAFFCNSGAEANEAAFKLARRVAFDRFGSEKYEIIAALNSFHGRTLFTVNVGGQSKYSDGFGPKITGITHVPYNDLAALKAAVSDKTCAVVLEPIQGEGGVLPAEQAYLQGARDLCDAHDALLVFDEVQTGMGRSGHLFAYMHYGVVPDILTSAKSLGGGFPIAAMLTTEALAKHLVVGTHGTTYGGNPLACAVAEAVIDVVNTPEVLGGVKTKHAKFKARLEQIGEKYGLFTQVRGLGLLIGCVLNDAWKGKAKDIFNAAEQEGLMILQAGPDVIRFAPSLVVEDADIDAGLDRFERAAAKLTQA
Hit FamilyFIG00138444
Hit Family FunctionSuccinylornithine transaminase (EC 2.6.1.81)


back to search