Query Sequence
>AO356_17010
MTAACLMTTYQPLALNFTHGLGTRLWDQDGREYLDAVAGVAVTNVGHSHPRLVAAISEQAGLLLHTSNLYSIDWQQRLAQKLTQLSGMERAFFNNSGAEANETALKLARLYGWHKGIEQPLVVVMDNAFHGRTLGTMSASDGPSVRLGYNRLPGDFIKVPFGDLAALEQIQQAHAERIVAVLVEPIQGESGVQLAPPGYLKALRQLCSRRAWLLMLDEIQTGIGRTGQWFAFQHEGIVPDVMTLAKGLGNGVPIGACLARGKAAELFTPGSHGSTFGGNPLACRVGCTVLDIIEEQALVGNARHQGEQLLSRLRTELAENPNVLAIRGQGLMIGIELKQPVRDLTLRAARDHGLLINVTRGQTIRLLPPLTIDGREVEMIVRGVSRCLAQG
Hit FamilyFIG00001168
Hit Family FunctionAcetylornithine aminotransferase (EC 2.6.1.11)


back to search