Query Sequence
>AO356_16420
MNAVTSVIGESVLSCSALGFQVRDAELLHDIHLDIRRGETLGLVGPNGSGKSTLLKLLAGVRAPSRGDIRLNNQPLKTLARRTVAQTLAVVEQQADTLDAISVFDAVALGRTPWLSALSPWSNEDAAIVQQALWDVDAAHLKNRTWHSLSGGERQRVHIARALAQRPQILLLDEPTNHLDIQHQLAILKVVQALPVTTVIALHDLNQALTCDRLAVLERGRLVALGKPLEVLTPQRLQDTFGVHAHYLIDPFDGAQILRFRSV
Hit FamilyFIG01963064
Hit Family FunctionCobalt ABC transporter, ATP-binding component CbtL


back to search