Query Sequence
>AO356_13705
MALISMRQMLDHAAEFGYGVPAFNVNNLEQMRAIMEAADKTDSPVIVQASAGARKYAGAPFLRHLILAAIEEFPHIPVCMHQDHGTSPDVCQRSIQLGFSSVMMDGSLGEDGKTPTDYEYNVRVTQQTVAMAHACGVSVEGELGCLGSLETGMAGEEDGIGAEGVLDHSQMLTDPEEAADFVKKTQVDALAIAIGTSHGAYKFTKPPTGDVLAIDRIKEIHKRIPNTHLVMHGSSSVPQEWLAIINQYGGDIKETYGVPVEEIVEGIKYGVRKVNIDTDLRLASTGAMRRLMATNPSEFDPRKFFGATVTAMRDVCIARYEAFGTAGNASKIKPISLEAMYQRYLKGELNAKVN
Hit FamilyFIG00000370
Hit Family FunctionFructose-bisphosphate aldolase class II (EC 4.1.2.13)


back to search