Query Sequence
>AO356_13450
MTPLETKRPLQLNDQGQLRHFLSLDGLRRELLTEILDTADSFLEVGARAVKKVPLLRGKTVCNVFFENSTRTRTTFELAAQRLSADVITLNVSTSSASKGETLLDTLRNLEAMAADMFVVRHGDSGAAHFIAEHVCPQVAIINGGDGRHAHPTQGMLDMLTIRRHKGSFENLSVAIVGDILHSRVARSNMLALKTLGCPDIRVIAPKTLLPIGVEQYGVKVYTDMTEGLKDVDVVIMLRLQRERMTGGLLPSEGEFYRLFGLTTARLAGAKPDAIVMHPGPINRGVEIESAVADGPHSVILNQVTYGIAIRMAVLSMAMSGQTAQRQFDQENAQ
Hit FamilyFIG00000122
Hit Family FunctionAspartate carbamoyltransferase (EC 2.1.3.2)


back to search