Query Sequence
>AO356_13420
MSNTRIAFIGAGNMAASLIGGLRAKGLDASLIRASDPGEETRTRVSAEHGIETFADNAQAIDGADVIVLAVKPQAMKTVCEALRPSLKPHQLVVSIAAGITCASMNNWLGEQPIVRCMPNTPALLRQGVSGLFATPHVSAEQRQQAETLLSAVGLALWLDTEQQLDAVTAVSGSGPAYFFLLIEAMTAAGEKLGLTRETAAQLTLQTALGAAHMAVSSDVDAAELRRRVTSPAGTTEAAIKSFQAGGFEALVEKALGAAAHRSAEMAEQLGQ
Hit FamilyFIG00133325
Hit Family FunctionPyrroline-5-carboxylate reductase (EC 1.5.1.2)


back to search