Query Sequence
>AO356_13080
MPLPSMKDQFAALIATPSVSCTQPGLDQSNSAVIELLAGWLTELGFSCDVQQVSPGKFNLLASFGSGPGGLVLAGHSDTVPFDGALWQTDPLKLTEVDGRWVGLGSCDMKGFFALAIEAVKPLLDQPFKQPLLILATCDEESSMAGARALADAGRPLGRAAVIGEPTGLRPIRLHKGVMMERIDILGRSGHSSDPSLGRSALEAMHDAMGELRGLRLQWQREFRNPQFSVPQPTLNFGCIHGGDNPNRICGQCSMEFDLRPLPGMDPQVLRAAIRQKLEPIAERHQVKIDYAPLFPEVPPFEQAEDAELVRVAERLTGHRAEAVAFGTEAPYLQRLGCETLVLGPGDIACAHQPGEYLEMSRLQPTVQLLRQLIGHYCLTPATAG
Hit FamilyFIG00020897
Hit Family FunctionAcetylornithine deacetylase (EC 3.5.1.16)


back to search