Query Sequence
>AO356_11880
MSNYDVVILGGGPGGYNAAIRAGQLGLKAACVEGRATLGGTCLNVGCMPSKALLHASELYEAATGTEFANLGIEVSPTLNLAQMMKQKDESVTGLTKGIEFLFRKNKVDWIKGWGHIDGPGKVTVTGDDGSKTELTAKDIVIATGSEPMPLPGVTIDNQRILDSTGALSLSEVPRHLVVIGAGVIGLELGSVWRRLGAQVTVVEYLDRICPGVDGEAGKTLQRALAKQGIQFKLSSKVTGATTSASGVQLQIEPAAGGEAQILDADYVLVAIGRRPYTQGLGLENVGLSTDKRGMLANQHHRTEAPGVWVIGDVTAGPMLAHKAEDEAMACIEQIAGKAAEVNYALIPSVIYTRPELASVGQTEEQLKAEGRAYKVGKFPFTANSRAKINHETEGFAKVLADERTDEILGVHLVGPSVSEMIGEYCVAMEFSASAEDIALTCHPHPTRSEALRQAAMNVEGMATQM
Hit FamilyFIG00136193
Hit Family FunctionDihydrolipoamide dehydrogenase (EC 1.8.1.4)


back to search