Query Sequence
>AO356_11625
MSGTQTSDNLAQGLKPRHVTMLSIAGVIGAGLFVGSGHAIAAAGPAVLLAYAAAGALVVLVMRMLGEMAVASPDTGSFSTYADRAIGHWAGFTIGWLYWWFWVLVIPLEANAAATILHAWFPNVAIWVFTLVITLLLTVTNLFSVKNYGEFEFWFALVKVVAIIGFIGLGLMAIFGVLPTSQVSGVSHLFDTQGFLPNGMGAVLGAILTTMFSFMGTEIVTIAAAESKNPGQQISKATNSVIWRIGLFYLVSIFIVVALVPWNDPLLASVGSYQTVLERMGIPNAKLIVDIVVLVAVTSCLNSALYTASRMMFSLGKRGDAPAVSQRTNKSGTPHWAVMLSTGAAFLAVFANYVAPAAVFEFLLASSGAIALLVYLVIAVSQLRMRKQRMARGEKIAFSMWLFPGLTYAVIVFIVGALTIMLFQEAHRVEILATGLLSVLVVISGVLIQRRRIVKAGSPVPTIG
Hit FamilyFIG00955203
Hit Family Functiontransport permease protein of gamma-aminobutyrate


back to search