Query Sequence
>AO356_09905
MMIDLHGFGPALAAGALMTVKLALSALCLGLVLGLLGALAKTSPYKPLQWLGGTYSTLVRGIPELLWVLLIYFGTVNLMRALGEYLGMPDLALNAFAAGVIALGLCFGAYATEVFRGAILAIPKGHREAGVALGLSKWRIFTRLIMPQMWRIALPGLGNLFMILMKDTALVSVIGLEEIMRHAQIGVTVSKQPFTFYMVAALMYLGLTVLAMLGMHLLERRAARGFARSTQ
Hit FamilyFIG00002732
Hit Family FunctionArginine ABC transporter, permease protein ArtQ


back to search