Query Sequence
>AO356_07045
MIRLEKILTPGRSLVNAPGGSKKKALEQTANLIHREVPDLGMQDVFEALVAREKLGSTGFGNGIAIPHCRLKGCTAPISALLHLEAPIDFDAIDGAPVDLLFVLLVPEAATDAHLELLRQIASMLDRKEVREKLRSAPSNEALYQVVLDEQNGH
Hit FamilyNo hits found for this sequence


back to search