Query Sequence
>AO356_05915
MSLENISCQKSFGGWHKRYRHRSDVLGCDMVFAVYLPPQAEQGGKLPVLYWLSGLTCTDENFMQKAGAQRMAAELGLIIVAPDTSPRGADVPGDPDNAWDFGLGAGFYLNATQDPWARHYRMHDYVVQELPALVEAHFPASDKRGISGHSMGGHGALVCALRNPGLYRSVSAFSPINNPMDCPWGQKAFSRYLGEDRSKWREWDACALIAEAQEKLPLLVDQGDRDDFLANQLKPEALQQAAKSAGHPLELRLQPGYDHSYFFIASFIDDHLQHHARALNA
Hit FamilyFIG00001809
Hit Family FunctionS-formylglutathione hydrolase (EC 3.1.2.12)


back to search