Query Sequence
>AO356_05190
MSSVAVFSKASPFDALQRWLPKLVLAPSMFIVLVGFYGYILWTFVLSFTTSTFLPNYKWAGLAQYARLMDNDRWWVASKNLVLFGGMFIGITLVIGVLLAVFLDQRIRREGFIRTIYLYPMALSMIVTGTAWKWLLNPGMGLDKLLRDWGWEGFRLDWLIDPDRVVYCLVIAAVWQASGFIMAMFLAGLRGVDQSIIRAAQIDGASMPRIYWKVVLPSLRPVFFSAVMILAHIAIKSFDLVAAMTAGGPGYSSDLPAMFMYSFTFSRGQMGMGSASAILMLGAILAIIVPYLYSELRTKRHD
Hit FamilyFIG00148781
Hit Family FunctionGlucose ABC transport system, inner membrane component 1


back to search