Query Sequence
>AO356_04095
VDKILHQPLGGNEMPRFGGIATMMRLPHLQTAAGLDAAFVGVPLDIGTSLRAGTRFGPREIRAESVMIRPYNMATGAAPFDSLSVADIGDVPINTFNLLDAVRIIEESYHKILEHNVIPLTLGGDHTITLPILRAIHKKHGKVGLVHIDAHADVNDHMFGEKIAHGTTFRRAVEEGLLDCDRVVQIGLRAQGYTADDFNWSRNQGFRVVQAEECWHKSLAPLMAEVREKVGGGPVYLSFDIDGIDPAWAPGTGTPEIGGLTTIQAIEIVRGCQGLDLVGCDLVEVSPPYDTTGNTSLLGANLLYEMLCVLPGVVHR
Hit FamilyFIG00052802
Hit Family FunctionAgmatinase (EC 3.5.3.11)


back to search