Query Sequence
>AO356_01320
MRTLELAGVSVPVIGQGTWRMGEEPSHHKKEVAALRLGIELGMTLIDTAEMYAEGGAETVVGEAITGLRDQVFLVSKVYPHNASRKGIPLACERSLRRLDTDYIDLYLLHWRGQYPLAETVEAFERLREEGKIGRWGVSNLDVDDLEELASPACATNQVLYNLQERGIEFDLLPWCQQRRMPIMAYCPVGQGGHLLKDHTLAQIAERHRATPAQIALAWLLRQDNVIAIPKAVKPEHVRLNAEAANLRLEPQDLAALDLIFPQPQGKQRLAMV
Hit FamilyFIG00003513
Hit Family FunctionOxidoreductase, aldo/keto reductase family


back to search