Query Sequence
>AO353_29320
MNRFGFSRMMLVLGLLFIYMPMLILVIYSFNASKLVTVWGGWSVKWYVGLLDNTQLMGSVVRSLEIACYTSIAAVALGTLAAFVLTRVTRFKGRTLFGGLVTAPLVMPEVITGLSLLLLFVAMAQMIGWPQERGIVTIWIAHTTFCAAYVAVVVSARLRELDLSIEEAAMDLGARPLKVFFLITIPMIAPSLAAGGMMSFALSLDDLVLASFVSGPGSTTLPMEVFSAVRLGVKPEINAVASLILLAVSIVTFMVWYFSRKAEATRKRAIQEAMDQTASESWKQPASQRPATQQIDATA
Hit FamilyFIG01304252
Hit Family FunctionPutrescine transport system permease protein PotI (TC 3.A.1.11.2)


back to search