Query Sequence
>AO353_26710
MQATTHPPATSARSKVSAIFRVTSGNFLEQFDFFLFGFYATYIAAAFFPASSEFASLMMTFAVFGAGFLMRPLGAVILGAYIDDVGRRKGLIVTLSIMASGTILIVLVPGYETIGLFAPALVLIGRLLQGFSAGAELGGVSVYLAEIATPGRKGFFTSWQSASQQVAIVVAAALGYALNQWMPATVVADWGWRIPFFVGCMIVPFIFLLRRSLEETAEFTARRHRPSMRQVFGTLLQNWQIVIAGMLMVALTTTAFYLITVYAPTFGKTVLHLSTSDALLVTLLVGVSNFCWLPLGGALSDRIGRRPVLVAMTLLTLATAYPALTYLVQAPSFINMLLVLLWLSFIYGLYNGAMVAALTEIMPVEVRVAGFSLAYSLATAVFGGFTPAISTFLIQYSGDKAAPGYWMSFAALCALCATLYLYRRSTGRLQVAVQ
Hit FamilyFIG01211486
Hit Family Functionmetabolite/H symporter, major facilitator superfamily (MFS)


back to search