Query Sequence
>AO353_24515
MTTLSLEAVSTVRSNAYRKTAWRLMPFLMLCYLCAYLDRVNVGFAKLQMMNDLALSETVYGLGAGMFFIGYFLCEVPSNIILHKVGARVWIARIMITWGIVSALFAFVETAWQFYALRFLLGIAEAGLAPGLLLYLTYWFPSYRRARMTVLWFIAIPLSGMVGGPLSGWIMNHFAGMHGWAGWQWMFVLEAVPTVLIGLLVLSYLKDGVHQASWLDDDEKALISRELAEDDQQKVTHASVGEFIRDRRLWLLAGIYFCVVMGQYAITFWLPTLVRNAGVSNPLHIGFLSSLPYLCAIAAMLYAGRSGDKHRERRWHLIVPMIAGAIGLSLAALMGGNVLLSILSLCLAASGILSATSMFWMLPTTLLGGVSAAAGIAAVNSFANLAGFCSPYLIGWVTTQTGSSAIGMYLITGVLLFGATLVLRIPAASVNR
Hit FamilyFIG00005529
Hit Family FunctionNitrate/nitrite transporter


back to search