Query Sequence
>AO353_23535
MSLRPEYLHSLLEEDKDQGIYRCKREMFTDPRLFDLEMQHIFEGNWLYLAHESQIPNKNDFYTTTMGRQSIFIARNKDGELNAFINACSHRGAMLCRHKTGNKSSYTCPFHGWTFNNSGKLLKVKDPAAAGYPASFNCEGSHDLTKVARFESYRGFLFGSLKADVVPLVEHLGESAKIIDMIVDQSADGLEVLRGSSSYIYEGNWKLTAENGADGYHVSSVHWNYAATQNQRKQRECGDENPTMSAGTWAKQGGGFYSFDKGHMLLWTRWSNPEDRPLYERRDELAKDFGQARADWMIENSRNLCLYPNVYLMDQFSSQIRIARPISVNRTEITIYCIAPKGESDSARSSRIRQYEDFFNVSGMATPDDLEEFRSCQTGYQGSVTTWNDMSRGAEHWVEGADEAAKEIDLHPLLSGVRTEDEGLFVLQHKYWQETMLKALSEEQSELIKVEALS
Hit FamilyNo hits found for this sequence


back to search