Query Sequence
>AO353_21710
MQRRLSLFTACVFLFAATASAVGIAQAADSRLDNVLKRGHLIVGTGSTNAPWHFQGADGKLQGFDIDIGRMVAKGLFNDPSKVEFVVQSSDARIPNLLTDKVDMSCQFITVTASRAQQVAFTLPYYREGVGLLLPANSKYKEIEDLKAAGDSVTVAVLQNVYAEELVHQALPKAKVDQYDSVDLMYQAVNSGRADTAATDQSSVKYLMVQNPGRYRSPTYAWSPQTYACAVKRGDQDWLNFVNTVLHEAMTGVEFPTYAASFKQWFGVDLPSPAIGFPVEFK
Hit FamilyFIG00510038
Hit Family FunctionGlutamine ABC transporter, periplasmic glutamine-binding protein (TC 3.A.1.3.2)


back to search