Query Sequence
>AO353_19655
MSVPAFGLGTFRLQGQVVIDSVSTGLELGYRAIDTAQIYDNEADVGQAIAASGIAREELFITSKIWIANFAKDQLIASLKDSLRKLQTDYLDLTLIHWPSPENQVPVHEFMGALLEAKALGLTRQIGVSNFTVDLMQQAIDAVGADNIATNQIELHPYLQNRTVVEFAQSQGIQITSYMTLAYGEVLKDPVIQQIAERHQATPAQVTLAWAMQQGYAVIPSSTQRANLDSNLAARELTLSEADMTLIAGLERGQRLTSPKGIAPDWD
Hit FamilyFIG00002143
Hit Family FunctionMethylglyoxal reductase, acetol producing (EC 1.1.1.-) / 2,5-diketo-D-gluconic acid reductase B (EC 1.1.1.274)


back to search