Query Sequence
>AO353_17195
MAEILSLHDAVKQFVNDGDTVALEGFTHLIPTAAGHEIIRQGKKDLTLVRMTPDLVYDQLIGAGCARKLIFSWGGNPGVGSLHRLRDAVEKQWPHALEIEEHSHADLANAYVAGASGLPFAVLRAYAGSDLPKVNPLIKSVTCPFTGEVLAAVPSVRPDVTVIHAQKADRKGNVLLWGILGVQKEAALAAKRCIVTVEEIVDDLKAPMNACVLPTWALSAVCHVPGGAHPSYAHGYTERDNRFYQAWDPIARDRETFTAWINEYIHGSADFSEFQAKLAKASEAQ
Hit FamilyFIG00002650
Hit Family Function3-oxoadipate CoA-transferase subunit A (EC 2.8.3.6); Glutaconate CoA-transferase subunit A (EC 2.8.3.12)


back to search