Query Sequence
>AO353_17190
MNQPQSAVGNCLDVQSFINAQPLSRYQWRVVILCFLIVFLDGLDTAAMGFIAPALSQDWGIDRASLGPVMSAALIGMVFGALGSGPLADRFGRKIVLVGAVLLFGAFSLASAYSTNVEQLLVLRFLTGLGLGAGMPNATTLLSEYTPERKKSLLVTSMFCGFNLGMAGGGFISAKLIPAFGWHSLLLIGGVLPLILGVVLLLWLPESARYLVVRNRGTDKVRKALAPIDPATIAQASSFSVPEQKTVKARNVFAVIFSGTYSTGTLLLWLTYFMGLVIVYLLTSWLPTLMRDSGASMEQAAFIGALFQFGGVLSAVAVGWAMDRFNPHKVIGTFYLLAGVFAYAVGQSLGNITLLATLVLVAGMCVNGAQSAMPSLAARFYPTQGRATGVSWMLGIGRFGAILGAWMGATLLGLGWNFEQVLTALVIPAALATTAVVIKGMVSHADAN
Hit FamilyFIG00015882
Hit Family Function4-hydroxybenzoate transporter


back to search