Query Sequence
>AO353_15200
MSESTSPVRVAVVQFDPQVGIENREGNLHHSLELALQAVNGGANLIVMPELTNTGYFFSNRQDAFDHSEAVPGGPSTQSWVDFACKHKVYLVAGLTERDGMRLFNTGILVGPDGFIGKYRKAHLWNLEKLWFTPGDLGFPVFDTPIGRIGLLICWDIWFPEVPRILSQQGADIICSLNNWVWTPPPLFDDAGKCMASYLTMTAAHVNNVFIAAASRIGEERGARYLGCSLIAGTNGWPIGAVASADKQEILFADIDLTSSRSAPIWNNLNDLHRDRRADLYDQMLGYTQHPCLPR
Hit FamilyFIG01324097
Hit Family FunctionAliphatic amidase AmiE (EC 3.5.1.4)


back to search