Query Sequence
>AO353_15040
MTTPRETRDYQAADAAHHIHAFVDQKALNDEGPRVMVRGDRLHLWDNDGRRYLDGMSGLWCTNLGYGRKDLAAAASRQLEQLPYYNMFFHTTHPQVIELSELLFSLLPGHYSHAIYTNSGSEANEVLIRTVRRYWTILGKPEKKVMIGRWNGYHGSTLAATALGGMKFMHEMGGMIPDIAHIDEPYFFAHEGNLTPAEFGLRAAQQLEEKILELGADKVAGFIAEPFQGAGGMIFPPESYWPEIQRICRKYDVLLCADEVIGGFGRTGEWFAHEHFGFEPDTLSIAKGLTSGYIPMGGLVLSKKMAQVLVEQGGVFAHGLTYSGHPVAAAVAIANLKALRDEGVVTRVKDDIGPYLQKCLREVFGNHPLVGDIQGVGMVAALQLAEDKTSRKRFANENDIAWRCRTIGFEEGVIIRSTLGRMIMAPALIATREEVDELVGKTLRAVDRTAQEYGQL
Hit FamilyFIG00001350
Hit Family FunctionOmega-amino acid--pyruvate aminotransferase (EC 2.6.1.18)


back to search