Query Sequence
>AO353_13675
MLKPAKLEKVLIANRGEIALRILRACKEMGIKTVAVYSKADKELMHLGLADESVCIGPASAAHSYLHIPAIIAAAEVTGATAIHPGYGFLAENADFAEQVENSGFAFIGPKAETIRLMGDKVSAKHAMIAAGVPTVPGSDGPLPEDEETALRIGREVGYPVIIKAAGGGGGRGMRVVHKEEDLISSAKLTRSEAGAAFGNPMVYLEKFLTNPRHVEVQVLSDGQGHAIHLGDRDCSLQRRHQKVLEEAPAPGIDEKARQEVFARCVKACIDIGYRGAGTFEFLYENGSFYFIEMNTRVQVEHPVSEMVTGIDIVKEMLSIAAGNPLSFTQDDVVIRGHALECRINAEDPKTFMPSPGTVKHFHAPGGNGVRVDSHLYSGYAVPPNYDSLIGKLITYGATREEAMARMRNALDEIVVDGIKTNIPLHRDLTRDEGFCKGGVNIHYLEHKLAAQH
Hit FamilyFIG00000420
Hit Family FunctionBiotin carboxylase of acetyl-CoA carboxylase (EC 6.3.4.14)


back to search