Query Sequence
>AO353_13635
MLHVLFSVYLKMLVLYSPFFVLSCFISLTRGYSRKEQRRLAWNVALATLVSSVLLYLFGRVIFSVFGITVDAFRIGAGSVLFISALGMAQGKSAVQTDNVQQDVTIVPLTIPLTVGPGTIGALLVMGVSQPHWDDKLTAILSIAMASLTVGVVLYLSNRIERILGDQGLQIVSRLMGLFVCALAAQIIFTGVKGYLVP
Hit FamilyFIG00955051
Hit Family Functionmembrane protein, MarC family


back to search