Query Sequence
>AO353_11990
MTIDLYGFGPALAAGALMTVKLALSALCLGLVLGLLGALAKTSPYKPLQWLGGTYSTLVRGIPELLWVLLIYFGTVNLMRALGEFFGNPDLALNAFAAGVIALGLCFGAYATEVFRGAILAIPKGHREAGVALGLSKLRIFTRLILPQMWRIALPGLGNLFMILMKDTALVSVIGLEEIMRHAQNGVTMTKQPFTFYMVAAFMYLGLTILAMTGMHLLEKRAARGFARNTQ
Hit FamilyFIG00002732
Hit Family FunctionArginine ABC transporter, permease protein ArtQ


back to search