Query Sequence
>AO353_11675
MNFSAFRRNLLVGSLGLVLGAGLLGQAVAGEQLQKIKEAGVINVGLEGTYPPFSFVDANGKLAGFEVEFSEALAKELGVKVKLQPTKWDGILAALESKRLDAVINQVTISEERKKKYDFSEPYTVSGIQALVLTKKVAELNIKTAADLTGKKVGVGLGTNYEQWVKANVPGAEVRTYEDDPTKFQDLRVGRTDVILIDRLAALEYAKKAKDTTAAGEAFSRQEAGIALRKGEPELLAAVNKAIDKLRADGTLKKLSEKYFSADVTQ
Hit FamilyFIG00001124
Hit Family FunctionCystine ABC transporter, periplasmic cystine-binding protein FliY


back to search