Query Sequence
>AO353_10790
MSDQDRDNPRREFLRKSLTLIPVVTVASTGLGSSVLMAAPEAAPAGPGKTPVSSSVYEPSYFTAEEWAFIQAAVARLIPADEQGPGALEAGVPEYIDRQMNTPYAAGALWYMQGPFNADAAPEMGWQSKLVPKDIYRLGIAATDAWSKAFNGKVFAAQDSATRDDLLKQLEAGTPTFDSVPPKIFFSLLLQNTKEGFFCDPIHGGNKGMVGWTMIGFPGARADFMDWVERNEQYPFPAVSIRGERA
Hit FamilyFIG00139722
Hit Family FunctionGluconate 2-dehydrogenase (EC 1.1.99.3), membrane-bound, gamma subunit


back to search